General Information

  • ID:  hor006055
  • Uniprot ID:  Q800F1(23-62)
  • Protein name:  Kininogen-1
  • Gene name:  NA
  • Organism:  Phyllomedusa sauvagei (Sauvage's leaf frog)
  • Family:  Frog skin active peptide (FSAP) family, Bradykinin-related peptide subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0090729 toxin activity
  • GO BP:  GO:0006952 defense response; GO:0035821 modulation of process of another organism
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EEEKRDTEEEENDDEIEEESEEKKREAPERPPGFTPFRIY
  • Length:  40(23-62)
  • Propeptide:  MDILKKSLFLVLFLGLVSFSICEEEKRDTEEEENDDEIEEESEEKKREAPERPPGFTPFRIY
  • Signal peptide:  MDILKKSLFLVLFLGLVSFSIC
  • Modification:  T32 4-hydroxyproline;T40 Sulfotyrosine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  [[Thr6]-bradykinin]: Inhibits ACE with a Ki of 1.6 uM, and targets B2 bradykinin receptor (BDKRB2). Provokes contraction of smooth muscle preparation (ileum). In vivo, induces an early hyperalgesic effects in living rats after intraplantar injection (By s
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q800F1-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006055_AF2.pdbhor006055_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 560888 Formula: C208H316N56O82
Absent amino acids: CHLMQVW Common amino acids: E
pI: 3.9 Basic residues: 7
Polar residues: 6 Hydrophobic residues: 5
Hydrophobicity: -225.25 Boman Index: -20141
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 22
Instability Index: 14134.25 Extinction Coefficient cystines: 1490
Absorbance 280nm: 38.21

Literature

  • PubMed ID:  14612182
  • Title:  Cloning of the (Thr6)-phyllokinin precursor from Phyllomedusa sauvagei skin confirms a non-consensus tyrosine O-sulfation motif.